PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006968-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 186aa    MW: 20567.8 Da    PI: 4.828
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006968-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.11.7e-072550126
                     TSSS-HHHHHHHHHHHHHTTTT-HHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWkt 26
                     rg WT+eE+++lvd v  +G   W +
    NNU_006968-RA 25 RGDWTAEEEQKLVDHVSVHGEAKWGS 50
                     899*****************999976 PP

2Myb_DNA-binding47.25e-155699247
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     g+++++E++l++++ ++lG++ W++Ia +++ gRt++++k++w  +
    NNU_006968-RA 56 GSFSEDEEDLIIRLYNLLGSR-WSLIAGRLP-GRTENEVKNHWIHH 99
                     78*******************.*********.***********876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-81852IPR009057Homeodomain-like
SuperFamilySSF466893.63E-172296IPR009057Homeodomain-like
PROSITE profilePS5129417.72650104IPR017930Myb domain
SMARTSM007174.1E-1354102IPR001005SANT/Myb domain
PfamPF002497.4E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1856101IPR009057Homeodomain-like
CDDcd001671.26E-1057100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MVKKNKEPRN ESAFGSSSSK KNVKRGDWTA EEEQKLVDHV SVHGEAKWGS LPAKEGSFSE  60
DEEDLIIRLY NLLGSRWSLI AGRLPGRTEN EVKNHWIHHL NKRVLTITEL NQRAGGGNSN  120
SQTSNVPTSV AEASNLSPVV DACCPFDTII RSSEGSTQMN PPSETESELY LDMDELLDFS  180
ALSDLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-132510427128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255778.11e-136PREDICTED: transcription factor TT2-like
RefseqXP_010255776.11e-136PREDICTED: transcription factor TT2-like
RefseqXP_010255775.11e-136PREDICTED: transcription factor TT2-like
TrEMBLK9LXG19e-35K9LXG1_9ASPA; R2R3 MYB
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.15e-29MYB family protein